(data stored in ACNUC7421 zone)

EMBL: CP000769.PE561

CP000769.PE561       Location/Qualifiers
FT   CDS             complement(646497..647948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0567"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: ade:Adeh_0516 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24781"
FT                   /db_xref="GOA:A7H7T5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T5"
FT                   /protein_id="ABS24781.1"
FT                   /translation="MRSAPHARAALGAAAVLLAGCTLAPRYQRPPAPVAEAWEAGSTPA
FT                   AAGPAAADLGWRDVFGDERLRALVALALENNRDLRVAALNVELARAQHRIQRAELLPAV
FT                   GASASVTRQHLGEDLSPTGEAQTTTGYTVGVGVAAFELDLFGRVRSLSAAALERYLATE
FT                   EARRAAHLSLVAEVATQYLSARALDDQVALARQTLETVESALALTRRTFEAGKTSELDL
FT                   RIAEAQVQTSRFNLSRALLLRAQAQNALVLLVGEALPAELPPPQPLETQALLAELPPGV
FT                   PSEVLRRRPDILAAEHALRSANASIGAARAAFFPSISLTAFGGTSSPELSGLFGAGATT
FT                   WSFTPRVNLPLFTGGALRASLDVAHLRKSIEVAQYERAIQGAFREVADALVARAALDEQ
FT                   LEAQRARTEAEQRRYDLSELRYRKGVDSYLGVLDAQRELFAARQLLIQSRLARLVNLVD
FT                   LYRALGGGWRERSAPSGGETATSGT"
     MRSAPHARAA LGAAAVLLAG CTLAPRYQRP PAPVAEAWEA GSTPAAAGPA AADLGWRDVF        60
     GDERLRALVA LALENNRDLR VAALNVELAR AQHRIQRAEL LPAVGASASV TRQHLGEDLS       120
     PTGEAQTTTG YTVGVGVAAF ELDLFGRVRS LSAAALERYL ATEEARRAAH LSLVAEVATQ       180
     YLSARALDDQ VALARQTLET VESALALTRR TFEAGKTSEL DLRIAEAQVQ TSRFNLSRAL       240
     LLRAQAQNAL VLLVGEALPA ELPPPQPLET QALLAELPPG VPSEVLRRRP DILAAEHALR       300
     SANASIGAAR AAFFPSISLT AFGGTSSPEL SGLFGAGATT WSFTPRVNLP LFTGGALRAS       360
     LDVAHLRKSI EVAQYERAIQ GAFREVADAL VARAALDEQL EAQRARTEAE QRRYDLSELR       420
     YRKGVDSYLG VLDAQRELFA ARQLLIQSRL ARLVNLVDLY RALGGGWRER SAPSGGETAT       480
     SGT                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page