(data stored in ACNUC7421 zone)

EMBL: CP000769.PE562

CP000769.PE562       Location/Qualifiers
FT   CDS             complement(647941..651105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0568"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   ade:Adeh_0517 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24782"
FT                   /db_xref="GOA:A7H7T6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T6"
FT                   /protein_id="ABS24782.1"
FT                   /translation="MAQFFIDRPIFAWVVAIIVMLAGALSILTLPVSQYPAIAPPTVSV
FT                   IASYPGASAKTLEDTVTQVIEQRMTGLDGLRYMSSSSDSSGNAQLTLTFEAGTNPDIAQ
FT                   VQVQNKLQLAMPQLPQDVQRQGVRVVKSAASFLLIIGLVSEDGSMTRNDISDYAYASIQ
FT                   DQISRVNGVGEVQTFGSQYAMRIWLDPDRLTSFRLTPLDVSSAVQSQNAQVSGGQLGGL
FT                   PAVEGQRLTATITAQTRLQTAEEFRNILLRVNPDGSQVRLGDVARVELAGESSEIETFF
FT                   NGRPSSGIGVRLAAGANALDTAGAVRARMDELSKFFPPGLKAVYPVDTSPFVRLSIEEV
FT                   VITLAEAIVLVFLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAAGFSINTLTMFGLV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLRPKSATRKSMSQITGALVGIALVLSAVFVPMAF
FT                   FGGSVGVIYRQFSITIVASMALSVLVALTLTPALCATLLKPVERGHGLARGGFFGAFNR
FT                   LYDRGAGRYGRVVGFLMRRRVRALIAYGVIVAALAGLFARMPTGFLPAEDQGTAFAQIL
FT                   LPPGSTLQSTREVLEKVSNHLLTEEKDSVESVMSIAGFSFSARGQNTGVAFIRLKPWDE
FT                   REGKHLKADAMAARAMRAFSTLKEANVFVFTPPAVSELGNANGFELQLQDRAGLGHDAL
FT                   MDARNQLLGLAQKDPRLAKVRPAGLEDTAQFKIDVDQQKAAALGISLADVNATIASTWG
FT                   VSYVNDFIDKGRTKRVYLQADAPFRMHPEDVGRWYVRQRGGEMVPFSAFATGSWTMGSP
FT                   KLERFNGLPAVAIQGEPAPGHSSGEAMAALEEIVGQLPSGVAADWSGLSYEERLSGANA
FT                   PALYALSILVVFLCLAALYESWSIPVSVLLAVPLGVIGAVIASSLRGLPNDVYFQVGLL
FT                   TTVGLSAKNAILIVEFARELHDRGRSAPAAALEAARMRLRPILMTSLAFVLGVLPLALA
FT                   SGAGAGSQNAIGFAVIGGMLSATALAILFVPLFFVLIARRAPAPAGVPPEDASGAEDVR
FT                   EDAAHA"
     MAQFFIDRPI FAWVVAIIVM LAGALSILTL PVSQYPAIAP PTVSVIASYP GASAKTLEDT        60
     VTQVIEQRMT GLDGLRYMSS SSDSSGNAQL TLTFEAGTNP DIAQVQVQNK LQLAMPQLPQ       120
     DVQRQGVRVV KSAASFLLII GLVSEDGSMT RNDISDYAYA SIQDQISRVN GVGEVQTFGS       180
     QYAMRIWLDP DRLTSFRLTP LDVSSAVQSQ NAQVSGGQLG GLPAVEGQRL TATITAQTRL       240
     QTAEEFRNIL LRVNPDGSQV RLGDVARVEL AGESSEIETF FNGRPSSGIG VRLAAGANAL       300
     DTAGAVRARM DELSKFFPPG LKAVYPVDTS PFVRLSIEEV VITLAEAIVL VFLVMYLFLQ       360
     NFRATLIPTI AVPVVLLGTF GVLAAAGFSI NTLTMFGLVL AIGLLVDDAI VVVENVERVM       420
     SEEGLRPKSA TRKSMSQITG ALVGIALVLS AVFVPMAFFG GSVGVIYRQF SITIVASMAL       480
     SVLVALTLTP ALCATLLKPV ERGHGLARGG FFGAFNRLYD RGAGRYGRVV GFLMRRRVRA       540
     LIAYGVIVAA LAGLFARMPT GFLPAEDQGT AFAQILLPPG STLQSTREVL EKVSNHLLTE       600
     EKDSVESVMS IAGFSFSARG QNTGVAFIRL KPWDEREGKH LKADAMAARA MRAFSTLKEA       660
     NVFVFTPPAV SELGNANGFE LQLQDRAGLG HDALMDARNQ LLGLAQKDPR LAKVRPAGLE       720
     DTAQFKIDVD QQKAAALGIS LADVNATIAS TWGVSYVNDF IDKGRTKRVY LQADAPFRMH       780
     PEDVGRWYVR QRGGEMVPFS AFATGSWTMG SPKLERFNGL PAVAIQGEPA PGHSSGEAMA       840
     ALEEIVGQLP SGVAADWSGL SYEERLSGAN APALYALSIL VVFLCLAALY ESWSIPVSVL       900
     LAVPLGVIGA VIASSLRGLP NDVYFQVGLL TTVGLSAKNA ILIVEFAREL HDRGRSAPAA       960
     ALEAARMRLR PILMTSLAFV LGVLPLALAS GAGAGSQNAI GFAVIGGMLS ATALAILFVP      1020
     LFFVLIARRA PAPAGVPPED ASGAEDVRED AAHA                                  1054
//

If you have problems or comments...

PBIL Back to PBIL home page