(data stored in ACNUC7421 zone)

EMBL: CP000769.PE564

CP000769.PE564       Location/Qualifiers
FT   CDS             652375..653004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0570"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ade:Adeh_0519
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24784"
FT                   /db_xref="GOA:A7H7T8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T8"
FT                   /protein_id="ABS24784.1"
FT                   /translation="MSDRADVGEPEAVPAKRRQILVGARRTFGELGFERASVDLIAARA
FT                   GVSKATVYHHFEDKQALFVACALEEAEAMRAGLRACLDQPAGDVEQGLQRIGEKVMRVL
FT                   LSPAVVGLHRHAIAEAGRFPEVGRTIFDRGPRLTQELIAAHLERWDRSGALRIDDPRSA
FT                   AVQFVALCQGDLLARARLAMLEYPADEQVRETVSRAVRTFVRAYRP"
     MSDRADVGEP EAVPAKRRQI LVGARRTFGE LGFERASVDL IAARAGVSKA TVYHHFEDKQ        60
     ALFVACALEE AEAMRAGLRA CLDQPAGDVE QGLQRIGEKV MRVLLSPAVV GLHRHAIAEA       120
     GRFPEVGRTI FDRGPRLTQE LIAAHLERWD RSGALRIDDP RSAAVQFVAL CQGDLLARAR       180
     LAMLEYPADE QVRETVSRAV RTFVRAYRP                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page