(data stored in ACNUC7421 zone)

EMBL: CP000769.PE570

CP000769.PE570       Location/Qualifiers
FT   CDS             complement(659879..660310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0576"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: gme:Gmet_0230 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24790"
FT                   /db_xref="GOA:A7H7U4"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U4"
FT                   /protein_id="ABS24790.1"
FT                   /translation="MDTRALAATAARLETLAYAALRLVAGAMFAFHGAQKILGWLPAGP
FT                   APALGTQLWFGGIIELVGGTLIALGLFTRAAAFLASGTMAVAYTQFHWKLAVANFAWLP
FT                   SVNKGELAALYCFLFLFVMARGPGPASLDAVLRGGARAR"
     MDTRALAATA ARLETLAYAA LRLVAGAMFA FHGAQKILGW LPAGPAPALG TQLWFGGIIE        60
     LVGGTLIALG LFTRAAAFLA SGTMAVAYTQ FHWKLAVANF AWLPSVNKGE LAALYCFLFL       120
     FVMARGPGPA SLDAVLRGGA RAR                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page