(data stored in ACNUC7421 zone)

EMBL: CP000769.PE573

CP000769.PE573       Location/Qualifiers
FT   CDS             complement(661088..661585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24793"
FT                   /db_xref="GOA:A7H7U7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U7"
FT                   /protein_id="ABS24793.1"
FT                   /translation="MSARATSIGRSATSGHGAGDASRTRLWAGRILTALPVLFLLFDGT
FT                   IKLLKLDPVVESFARLGYPATIARGIGGLELALIAVTLVPRTSLLGAVLLTGYLGGAVS
FT                   THVRVGDPLFTHVLFPSYVGVLLWSGLYLRDDRLRTLMASRRGRAGSTGAAPSWRSERA
FT                   AS"
     MSARATSIGR SATSGHGAGD ASRTRLWAGR ILTALPVLFL LFDGTIKLLK LDPVVESFAR        60
     LGYPATIARG IGGLELALIA VTLVPRTSLL GAVLLTGYLG GAVSTHVRVG DPLFTHVLFP       120
     SYVGVLLWSG LYLRDDRLRT LMASRRGRAG STGAAPSWRS ERAAS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page