(data stored in ACNUC7421 zone)

EMBL: CP000769.PE574

CP000769.PE574       Location/Qualifiers
FT   CDS             complement(661582..662367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0580"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: bxe:Bxe_B0232
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24794"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U8"
FT                   /protein_id="ABS24794.1"
FT                   /translation="MRVMIMHKVNESTEAGVLPGPEVLAGMGRLIQEMVQAGVFLDAAG
FT                   LKPSSTRVRLNFSRGEREVTKGPLVGRNELIAGFALMKVRSMEEAIAWATRFAQVVGDV
FT                   EIDVGPVTEPWDLGVAPRPPGEVPLRVLAMHKADESSEAFAAPNPETMAEMGKLIEEMT
FT                   KAGVLLATEGLKPSSEGWRLRYGGGKRTVIDGPFAESKELIAGYVMLRVKSREELLDWA
FT                   GRFAAVVGDVELDVRPLFEDSDLAPVEPHGRGAAEGRRA"
     MRVMIMHKVN ESTEAGVLPG PEVLAGMGRL IQEMVQAGVF LDAAGLKPSS TRVRLNFSRG        60
     EREVTKGPLV GRNELIAGFA LMKVRSMEEA IAWATRFAQV VGDVEIDVGP VTEPWDLGVA       120
     PRPPGEVPLR VLAMHKADES SEAFAAPNPE TMAEMGKLIE EMTKAGVLLA TEGLKPSSEG       180
     WRLRYGGGKR TVIDGPFAES KELIAGYVML RVKSREELLD WAGRFAAVVG DVELDVRPLF       240
     EDSDLAPVEP HGRGAAEGRR A                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page