(data stored in ACNUC7421 zone)

EMBL: CP000769.PE581

CP000769.PE581       Location/Qualifiers
FT   CDS             667518..668396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24801"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V5"
FT                   /protein_id="ABS24801.1"
FT                   /translation="MTKRLALASLLLATSALAADPQMKPFVLASRGAGDVEAAASTARQ
FT                   KLQAAGFEIAGSYAPYPGAVVLAVTNETLKAEGAKTGSGGYVAAQRVTITRVGEEVQVA
FT                   FTNPVYMAAAYRLPGDLAPVTASLQGALGRIEEYGPSEGKSAKELRKYHYMVGMEYFDE
FT                   PSKLGHFASHDEAVRAVEAGLAERRGGASKVYRIDLPGGRQTVFGVALTDGCSGDARIM
FT                   KEIDFKPVRSTGHLPYEILVTEGDVRALYARFRIAVNFPDLKMMGSHSFMDIRCAPDAI
FT                   EKALKAVAGAR"
     MTKRLALASL LLATSALAAD PQMKPFVLAS RGAGDVEAAA STARQKLQAA GFEIAGSYAP        60
     YPGAVVLAVT NETLKAEGAK TGSGGYVAAQ RVTITRVGEE VQVAFTNPVY MAAAYRLPGD       120
     LAPVTASLQG ALGRIEEYGP SEGKSAKELR KYHYMVGMEY FDEPSKLGHF ASHDEAVRAV       180
     EAGLAERRGG ASKVYRIDLP GGRQTVFGVA LTDGCSGDAR IMKEIDFKPV RSTGHLPYEI       240
     LVTEGDVRAL YARFRIAVNF PDLKMMGSHS FMDIRCAPDA IEKALKAVAG AR               292
//

If you have problems or comments...

PBIL Back to PBIL home page