(data stored in ACNUC7421 zone)

EMBL: CP000769.PE582

CP000769.PE582       Location/Qualifiers
FT   CDS             complement(668402..669505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0588"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   mxa:MXAN_2683 methyl accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24802"
FT                   /db_xref="GOA:A7H7V6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V6"
FT                   /protein_id="ABS24802.1"
FT                   /translation="MFARRYAWYGAAFGACFPVIATVLEAASRHGGVGPAALAAALRSP
FT                   LLWIVALAPLVLALLARVAGVRQDRAVAIDAARREAYVRAAGELAGAARSLAEEATRIR
FT                   GGAAEQAAGAAQQASAIAQTSTSAAEIAQMAVRSAERAEGVIAVTDRSGDLSTEGQRAV
FT                   ERVVSGIEDLAAAVESIAQATAELAADARRIGDIVETVKDVAEQSNVLAVNAALEAARA
FT                   GEHGRGFGTVAVEVRSLAEQSRGAAVEVARIVGGVLARVERTASAASEGRSRADGVIAL
FT                   ARSTATAIDSLGGLVRDSATEAREIALAARQQTLGIDEIVAAMGQISAATSAAVSSAAG
FT                   IEQAAKALAEMSHSLGATVERYRAAAE"
     MFARRYAWYG AAFGACFPVI ATVLEAASRH GGVGPAALAA ALRSPLLWIV ALAPLVLALL        60
     ARVAGVRQDR AVAIDAARRE AYVRAAGELA GAARSLAEEA TRIRGGAAEQ AAGAAQQASA       120
     IAQTSTSAAE IAQMAVRSAE RAEGVIAVTD RSGDLSTEGQ RAVERVVSGI EDLAAAVESI       180
     AQATAELAAD ARRIGDIVET VKDVAEQSNV LAVNAALEAA RAGEHGRGFG TVAVEVRSLA       240
     EQSRGAAVEV ARIVGGVLAR VERTASAASE GRSRADGVIA LARSTATAID SLGGLVRDSA       300
     TEAREIALAA RQQTLGIDEI VAAMGQISAA TSAAVSSAAG IEQAAKALAE MSHSLGATVE       360
     RYRAAAE                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page