(data stored in ACNUC7421 zone)

EMBL: CP000769.PE584

CP000769.PE584       Location/Qualifiers
FT   CDS             670296..671210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0590"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein;
FT                   KEGG: ttj:TTHB098 NADH-ubiquinone oxidoreductase 39 kDa
FT                   subunit related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24804"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V8"
FT                   /protein_id="ABS24804.1"
FT                   /translation="MSRPHVHAITGAFGYSGQEIARLLLARGERVRTLTGHPERPDPFG
FT                   GRVEVTRFRFDDPSRLRDALAGVRVLYNTYWVRFDHGASTFARAVENSRALFRAAAEAG
FT                   VERVVHVSITNPAPDSPLPYFRGKAEVERALGESGLSHAILRPAVFFGGRDVLINNIAW
FT                   LLRRLPLFGVASGTYGIQPVHVEDLARLAVEHAERGADVVLDAVGPEAFAFDELVGLVR
FT                   RAVRSRAAIVRVPRWLLLGAARALGAPLGDVVLTRDEVLGLTGNLLVSHGRPTAGTRFS
FT                   DWLAAHADELGVAWASELGRHYK"
     MSRPHVHAIT GAFGYSGQEI ARLLLARGER VRTLTGHPER PDPFGGRVEV TRFRFDDPSR        60
     LRDALAGVRV LYNTYWVRFD HGASTFARAV ENSRALFRAA AEAGVERVVH VSITNPAPDS       120
     PLPYFRGKAE VERALGESGL SHAILRPAVF FGGRDVLINN IAWLLRRLPL FGVASGTYGI       180
     QPVHVEDLAR LAVEHAERGA DVVLDAVGPE AFAFDELVGL VRRAVRSRAA IVRVPRWLLL       240
     GAARALGAPL GDVVLTRDEV LGLTGNLLVS HGRPTAGTRF SDWLAAHADE LGVAWASELG       300
     RHYK                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page