(data stored in ACNUC7421 zone)

EMBL: CP000769.PE62

CP000769.PE62        Location/Qualifiers
FT   CDS             79057..79413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0062"
FT                   /product="sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /note="PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: ade:Adeh_0060 sec-independent
FT                   translocation protein MttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24282"
FT                   /db_xref="GOA:A7H6D6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D6"
FT                   /protein_id="ABS24282.1"
FT                   /translation="MFGLGFGEIIIIAILALLLLGPERLPEAAKALGKTLRDVRRATDD
FT                   IKGQIETEIYAEERKAAKPALVPPVPAAPLAPAGPPPPATSENVPGLEAALAEPPASAS
FT                   PETTPGEPAPSRTA"
     MFGLGFGEII IIAILALLLL GPERLPEAAK ALGKTLRDVR RATDDIKGQI ETEIYAEERK        60
     AAKPALVPPV PAAPLAPAGP PPPATSENVP GLEAALAEPP ASASPETTPG EPAPSRTA         118
//

If you have problems or comments...

PBIL Back to PBIL home page