(data stored in ACNUC7421 zone)

EMBL: CP000769.PE65

CP000769.PE65        Location/Qualifiers
FT   CDS             81805..82002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24285"
FT                   /db_xref="GOA:A7H6D9"
FT                   /db_xref="InterPro:IPR023128"
FT                   /db_xref="InterPro:IPR037132"
FT                   /db_xref="InterPro:IPR037259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D9"
FT                   /protein_id="ABS24285.1"
FT                   /translation="MASFTGVKVFSTTLARDREHMGEQVGRWLAEHPDYEVVEREVRQS
FT                   SDKEFHCLSIILFYRDRRKA"
     MASFTGVKVF STTLARDREH MGEQVGRWLA EHPDYEVVER EVRQSSDKEF HCLSIILFYR        60
     DRRKA                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page