(data stored in ACNUC7421 zone)

EMBL: CP000769.PE66

CP000769.PE66        Location/Qualifiers
FT   CDS             82009..82743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0066"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ade:Adeh_0064
FT                   rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24286"
FT                   /db_xref="GOA:A7H6E0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E0"
FT                   /protein_id="ABS24286.1"
FT                   /translation="MPTARRRAPRLGDTFTFGGRVPAVVGLLIAAMAVVTIASWLDRRL
FT                   LQLLAFDPASVLYGQLWRLLTWVFVQDSPLTLFFAGFMLWWLGQQLVYVWGERRFLLRF
FT                   LGITVGAGVLATLFALVYRPAAVGHVNAWPTVNGLLVAWALMFPDRPLSWFGVINMSAK
FT                   MMAALVAFGTVLYAIAYGGPGRFAVHFAALAIGWALSRGLSFGGFFRKARRNLEEREAR
FT                   RRAKHLKVVRRNGQDEPPRWMN"
     MPTARRRAPR LGDTFTFGGR VPAVVGLLIA AMAVVTIASW LDRRLLQLLA FDPASVLYGQ        60
     LWRLLTWVFV QDSPLTLFFA GFMLWWLGQQ LVYVWGERRF LLRFLGITVG AGVLATLFAL       120
     VYRPAAVGHV NAWPTVNGLL VAWALMFPDR PLSWFGVINM SAKMMAALVA FGTVLYAIAY       180
     GGPGRFAVHF AALAIGWALS RGLSFGGFFR KARRNLEERE ARRRAKHLKV VRRNGQDEPP       240
     RWMN                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page