(data stored in ACNUC7421 zone)

EMBL: CP000769.PE68

CP000769.PE68        Location/Qualifiers
FT   CDS             85470..87446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0068"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   ade:Adeh_0066 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24288"
FT                   /db_xref="GOA:A7H6E2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E2"
FT                   /protein_id="ABS24288.1"
FT                   /translation="MISLAPAAMYGAPMNRLPVLHDGRAQPPAARADSFLPTSAAELRA
FT                   RGWSALDVLLVTGDAYVDHPSFGAAVIGRVLEAQGYKVGIVAQPDWRSTADVLRMGRPR
FT                   LFVGVTSGAMDSMVNHYTAHKRRRSDDAYTPDAVAGKRPDRATTAYARLCRQAFGATTP
FT                   IVVGGIEASLRRIAHYDYWDDRVLPSVLVPSGADLLVYGQGEKPVLEIARRLASGEDLC
FT                   GLVDVPGTALAVPDLALAMLEGRERKTLELPAYEEIALDRRRFAEFSRLYHLEHNAENA
FT                   RILVQRHGRGERARFVVVNEPMAAPSTEELDRIAELPYVREAHPSYGGAHIPALEQIRW
FT                   SIQILRGCAAGCAFCCITEHQGRDIASRSEASVLRELATLASKESFKGTITDVGGATAN
FT                   MWGMRCTDAEAHAVCRRASCVYPTVCKFFAVDHGPLVDLYEKARKVKGVKHLFVGSGVR
FT                   YDLAQADTKNGARYLKTLVQHHVSGQLKVAPEHVCEPVLKLMKKPGVSSFERLRKDFER
FT                   YSREAGKEQYLVPYFISSHPGSSLEQAAELMDYLQDNRWKPQQVQDFMPTPMTLASDMY
FT                   WSGYHPMTGEPVHVTRDMDEKRMQKALLRWGDPANRPLIEKALRKLGRLKPGERLGPGM
FT                   RPSRGSPKRRGPAGGPGPRRPRA"
     MISLAPAAMY GAPMNRLPVL HDGRAQPPAA RADSFLPTSA AELRARGWSA LDVLLVTGDA        60
     YVDHPSFGAA VIGRVLEAQG YKVGIVAQPD WRSTADVLRM GRPRLFVGVT SGAMDSMVNH       120
     YTAHKRRRSD DAYTPDAVAG KRPDRATTAY ARLCRQAFGA TTPIVVGGIE ASLRRIAHYD       180
     YWDDRVLPSV LVPSGADLLV YGQGEKPVLE IARRLASGED LCGLVDVPGT ALAVPDLALA       240
     MLEGRERKTL ELPAYEEIAL DRRRFAEFSR LYHLEHNAEN ARILVQRHGR GERARFVVVN       300
     EPMAAPSTEE LDRIAELPYV REAHPSYGGA HIPALEQIRW SIQILRGCAA GCAFCCITEH       360
     QGRDIASRSE ASVLRELATL ASKESFKGTI TDVGGATANM WGMRCTDAEA HAVCRRASCV       420
     YPTVCKFFAV DHGPLVDLYE KARKVKGVKH LFVGSGVRYD LAQADTKNGA RYLKTLVQHH       480
     VSGQLKVAPE HVCEPVLKLM KKPGVSSFER LRKDFERYSR EAGKEQYLVP YFISSHPGSS       540
     LEQAAELMDY LQDNRWKPQQ VQDFMPTPMT LASDMYWSGY HPMTGEPVHV TRDMDEKRMQ       600
     KALLRWGDPA NRPLIEKALR KLGRLKPGER LGPGMRPSRG SPKRRGPAGG PGPRRPRA         658
//

If you have problems or comments...

PBIL Back to PBIL home page