(data stored in ACNUC7421 zone)

EMBL: CP000769.PE7

CP000769.PE7         Location/Qualifiers
FT   CDS             8722..9318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24227"
FT                   /db_xref="UniProtKB/TrEMBL:A7H681"
FT                   /protein_id="ABS24227.1"
FT                   /translation="MRICPLLGFLDAEETRVGCLAHPLATGGADLRDCGAYDVATCDAF
FT                   LCPSHAFLSEEEAAILDGALAGDFHLYGLVVTDVPFLRAALAGVSARTGAKVELRQLAH
FT                   AAFRAALRRLLALKEELAPGSDGLFGAFRPGKNGEDLPRRIDYDALGSAPSPYDEILTC
FT                   VGADPRSGNDLEALEGEVARRLDAAAAAFPVPARR"
     MRICPLLGFL DAEETRVGCL AHPLATGGAD LRDCGAYDVA TCDAFLCPSH AFLSEEEAAI        60
     LDGALAGDFH LYGLVVTDVP FLRAALAGVS ARTGAKVELR QLAHAAFRAA LRRLLALKEE       120
     LAPGSDGLFG AFRPGKNGED LPRRIDYDAL GSAPSPYDEI LTCVGADPRS GNDLEALEGE       180
     VARRLDAAAA AFPVPARR                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page