(data stored in ACNUC7421 zone)

EMBL: CP000769.PE73

CP000769.PE73        Location/Qualifiers
FT   CDS             complement(91139..92518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0073"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: ade:Adeh_0073 peptidase
FT                   S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24293"
FT                   /db_xref="GOA:A7H6E7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E7"
FT                   /protein_id="ABS24293.1"
FT                   /translation="MRAHRAILASLALGASVLAASASARPNALPRPDERPSPSRRTPVV
FT                   QAVEKVRGAVVNVSAEELVRIRVPSRASSMAELLFGDFFEKPRFRKGYAVSSLGSGVIV
FT                   SPDGYVLTNNHVVERGARFRVGLLDGREINAKVVGTDPSSDLAVLKLETKERLPFATLG
FT                   RSDDLLIGETLIAIGNPFGLSHTVTTGVVSAVHRNFRAGDRMLFDFVQTDASINPGNSG
FT                   GALLDIEGRLVGINTAILGDRNAGIGFAIPIDRARRIAEDLIAHGEVREGYVGVAVDDL
FT                   PAKDGAAEGASGGVVVTGVDPGSPAAKAGVKKGDVVEAVQGFAARSAEEFRFRMRDLPI
FT                   GQAARLELVRGGKRIALSVPSVELSPEAAAQLATRSTGLTLAEERLHRGSVLIVKTVAP
FT                   ASPAARVGIRQGDLVREVNSTEVATLADFRRAAARARRSGQLVLLVQRGYAAERIAFDF
FT                   Q"
     MRAHRAILAS LALGASVLAA SASARPNALP RPDERPSPSR RTPVVQAVEK VRGAVVNVSA        60
     EELVRIRVPS RASSMAELLF GDFFEKPRFR KGYAVSSLGS GVIVSPDGYV LTNNHVVERG       120
     ARFRVGLLDG REINAKVVGT DPSSDLAVLK LETKERLPFA TLGRSDDLLI GETLIAIGNP       180
     FGLSHTVTTG VVSAVHRNFR AGDRMLFDFV QTDASINPGN SGGALLDIEG RLVGINTAIL       240
     GDRNAGIGFA IPIDRARRIA EDLIAHGEVR EGYVGVAVDD LPAKDGAAEG ASGGVVVTGV       300
     DPGSPAAKAG VKKGDVVEAV QGFAARSAEE FRFRMRDLPI GQAARLELVR GGKRIALSVP       360
     SVELSPEAAA QLATRSTGLT LAEERLHRGS VLIVKTVAPA SPAARVGIRQ GDLVREVNST       420
     EVATLADFRR AAARARRSGQ LVLLVQRGYA AERIAFDFQ                              459
//

If you have problems or comments...

PBIL Back to PBIL home page