(data stored in ACNUC7421 zone)

EMBL: CP000769.PE74

CP000769.PE74        Location/Qualifiers
FT   CDS             complement(92522..92755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24294"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E8"
FT                   /protein_id="ABS24294.1"
FT                   /translation="MADQPENKLVDKRVAQRYLRKGVLDEKDYEKHLKSLPDLADQAMP
FT                   IEASMDSDDRDDLDDVDDEPESPADTGEAPQT"
     MADQPENKLV DKRVAQRYLR KGVLDEKDYE KHLKSLPDLA DQAMPIEASM DSDDRDDLDD        60
     VDDEPESPAD TGEAPQT                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page