(data stored in ACNUC7421 zone)

EMBL: CP000769.PE78

CP000769.PE78        Location/Qualifiers
FT   CDS             complement(95034..96458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0078"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: ade:Adeh_0079
FT                   replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24298"
FT                   /db_xref="GOA:A7H6F2"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F2"
FT                   /protein_id="ABS24298.1"
FT                   /translation="MAEHDPVRRVSEAPVAPLRSARDLPHSLEAEQAVIGAILVEETAF
FT                   DQVAALIKSGDFYLLAHQHVYAVCEELARESKTLDPILVQQRLDAKGLLGSAVPRELPL
FT                   SLARAIGTTANVQHYGRTVQELARLRQMMLTAQRVVERGYEAGASVQQFLDSAQQDVFG
FT                   AAQGTGTETLKKIAEPVMRAIENLEAVQKRVQAGLSPITGVPTGIQSLDKNTLGFQPGT
FT                   LTVLAARPSVGKTAFALNIATHAATRAGKKVAFFSLEMPSDQLALRMLASEARLDWRRL
FT                   SAGQLSAYDWQKIATHADKLGAASIWLDDNFVLTPVELRSKCRKLKRENGGLDLVMIDY
FT                   LQLMHAPSDRASQSREQEIATISRSLKSLAKELECPIVALSQLNRGVEKRKGEPPMLSD
FT                   LRESGAIEQDADIVMFLHRNDEDNKDVQSGTASGDTLEVQLVVAKQRQGPTGTIPLVFF
FT                   KTTTYFAEMERRRDGQ"
     MAEHDPVRRV SEAPVAPLRS ARDLPHSLEA EQAVIGAILV EETAFDQVAA LIKSGDFYLL        60
     AHQHVYAVCE ELARESKTLD PILVQQRLDA KGLLGSAVPR ELPLSLARAI GTTANVQHYG       120
     RTVQELARLR QMMLTAQRVV ERGYEAGASV QQFLDSAQQD VFGAAQGTGT ETLKKIAEPV       180
     MRAIENLEAV QKRVQAGLSP ITGVPTGIQS LDKNTLGFQP GTLTVLAARP SVGKTAFALN       240
     IATHAATRAG KKVAFFSLEM PSDQLALRML ASEARLDWRR LSAGQLSAYD WQKIATHADK       300
     LGAASIWLDD NFVLTPVELR SKCRKLKREN GGLDLVMIDY LQLMHAPSDR ASQSREQEIA       360
     TISRSLKSLA KELECPIVAL SQLNRGVEKR KGEPPMLSDL RESGAIEQDA DIVMFLHRND       420
     EDNKDVQSGT ASGDTLEVQL VVAKQRQGPT GTIPLVFFKT TTYFAEMERR RDGQ             474
//

If you have problems or comments...

PBIL Back to PBIL home page