(data stored in ACNUC7421 zone)

EMBL: CP000769.PE79

CP000769.PE79        Location/Qualifiers
FT   CDS             96711..97541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0079"
FT                   /product="Water Stress and Hypersensitive response domain
FT                   protein"
FT                   /note="SMART: Water Stress and Hypersensitive response
FT                   domain protein; KEGG: ade:Adeh_0080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24299"
FT                   /db_xref="GOA:A7H6F3"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F3"
FT                   /protein_id="ABS24299.1"
FT                   /translation="MKKTFALALLALTGAGCAGLSDLARVAFEEPKLSFRSASVEALDL
FT                   EGATIGVKFDLENPNGFGLDVARVGWGVEVEGTRVATGDMPGGLAIPAKGVAPLTIPVR
FT                   VRYQDVPGIVGLLTSRRDAIGYRLSGKVGVRTPIGIVDLPVSHSDRVALPSLPSFSLEG
FT                   VSLRTASFTDMALDVKLRVKNPNAFPIPAGSLDYALSLAGTEVVRAQDTALARVAGGAA
FT                   QIVSIPVRVSVLKAGRAATELARGAPVQLGLAGTADVAGIPVPLDLAATVPARR"
     MKKTFALALL ALTGAGCAGL SDLARVAFEE PKLSFRSASV EALDLEGATI GVKFDLENPN        60
     GFGLDVARVG WGVEVEGTRV ATGDMPGGLA IPAKGVAPLT IPVRVRYQDV PGIVGLLTSR       120
     RDAIGYRLSG KVGVRTPIGI VDLPVSHSDR VALPSLPSFS LEGVSLRTAS FTDMALDVKL       180
     RVKNPNAFPI PAGSLDYALS LAGTEVVRAQ DTALARVAGG AAQIVSIPVR VSVLKAGRAA       240
     TELARGAPVQ LGLAGTADVA GIPVPLDLAA TVPARR                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page