(data stored in ACNUC7421 zone)

EMBL: CP000769.PE80

CP000769.PE80        Location/Qualifiers
FT   CDS             97667..98983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0080"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: CBS domain
FT                   containing protein; MgtE integral membrane region; KEGG:
FT                   ade:Adeh_3944 magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24300"
FT                   /db_xref="GOA:A7H6F4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F4"
FT                   /protein_id="ABS24300.1"
FT                   /translation="MDADELVDVPLTAEELRDAWPALSWEERIEGFHRLVRAEADDFFL
FT                   ELPPADEAALLLALPPPERRLWIRLLAPDDAADVIQETPEEERPRLIELLDPVARREVT
FT                   ALLAYAEDAAGGLMSPRFARLRPEMTADEAIRYLRRQAREQAETIYYAYVLDPEQKLSG
FT                   VVSFRDLLTAPPDRRISELMKRDVVSVPDTLDQEAVARIMAREDINAIPVVDGQGRMQG
FT                   IVTVDDVVDVVQQEATEDIQKIGGTEALDAPYLDTGLFAMVKKRAGWLALLFVGEMMTA
FT                   SAMGRFEEHIASAVVLALFVPLIISSGGNSGSQASTLVIRAMALGEVGIADAWRVARRE
FT                   ILSGLVLGGILAVLGVVRIFLWQGLFGTYGHQAARLALTVGSSVIAVVTFGTIAGSMMP
FT                   LLIRRLGFDPASASAPFIATMVDVSGVVIYFSMARLVLL"
     MDADELVDVP LTAEELRDAW PALSWEERIE GFHRLVRAEA DDFFLELPPA DEAALLLALP        60
     PPERRLWIRL LAPDDAADVI QETPEEERPR LIELLDPVAR REVTALLAYA EDAAGGLMSP       120
     RFARLRPEMT ADEAIRYLRR QAREQAETIY YAYVLDPEQK LSGVVSFRDL LTAPPDRRIS       180
     ELMKRDVVSV PDTLDQEAVA RIMAREDINA IPVVDGQGRM QGIVTVDDVV DVVQQEATED       240
     IQKIGGTEAL DAPYLDTGLF AMVKKRAGWL ALLFVGEMMT ASAMGRFEEH IASAVVLALF       300
     VPLIISSGGN SGSQASTLVI RAMALGEVGI ADAWRVARRE ILSGLVLGGI LAVLGVVRIF       360
     LWQGLFGTYG HQAARLALTV GSSVIAVVTF GTIAGSMMPL LIRRLGFDPA SASAPFIATM       420
     VDVSGVVIYF SMARLVLL                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page