(data stored in ACNUC7421 zone)

EMBL: CP000769.PE84

CP000769.PE84        Location/Qualifiers
FT   CDS             102451..102708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24304"
FT                   /db_xref="GOA:A7H6F8"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F8"
FT                   /protein_id="ABS24304.1"
FT                   /translation="MAEAVYLLCALTSIACAALLVRSYLATRVRLTLWSALCFVGLALN
FT                   NVMLYVDHIVVPGADLWLLRTAPAVLGIGVLVAGLVWEST"
     MAEAVYLLCA LTSIACAALL VRSYLATRVR LTLWSALCFV GLALNNVMLY VDHIVVPGAD        60
     LWLLRTAPAV LGIGVLVAGL VWEST                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page