(data stored in ACNUC7421 zone)

EMBL: CP000769.PE86

CP000769.PE86        Location/Qualifiers
FT   CDS             complement(102967..104379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0086"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; AAA ATPase;
FT                   KEGG: ade:Adeh_3091 sigma54 specific transcriptional
FT                   regulator with PAS sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24306"
FT                   /db_xref="GOA:A7H6G0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G0"
FT                   /protein_id="ABS24306.1"
FT                   /translation="MIPSLPYLGLGSAESLQQVADAFPDGVFTTDRDGVITYWNPAAGA
FT                   ITGYSAAEAIGRTCALLAGDMGRGCMCGGGPVRCGISDRGKSSKCCSIRTKDGRERLIV
FT                   KNAVAFHGPDGTVAGALESFTDVTDLSVGAIPWESACALPAPSAGVAAAAEAAPPESEC
FT                   AGLLGCHPVMRELYRMIALVARSDATVMILGESGVGKERVAEAIHRQSRRAAGPLVRVS
FT                   CSALNENLLESELFGHVKGAFTGALRDRRGRFQEAHGGTLLLDEIGDISPAVQVKLLRV
FT                   IEQRVVERVGDSQPLPVDVRLLCATHRDLKQLVTDGRFRADLYFRLAVFPLRVPPLRER
FT                   AEDVALLSEGFLARLGAPPPSPEASRLLAAYAWPGNVRELQNVLEYAALQAGGAPISPA
FT                   HLPAEIRGAAPPTPERAAPDRSAIVEALIRTGWNRARAADVLGISRVTLWKRMKRLGVV
FT                   GPGPMASGREPL"
     MIPSLPYLGL GSAESLQQVA DAFPDGVFTT DRDGVITYWN PAAGAITGYS AAEAIGRTCA        60
     LLAGDMGRGC MCGGGPVRCG ISDRGKSSKC CSIRTKDGRE RLIVKNAVAF HGPDGTVAGA       120
     LESFTDVTDL SVGAIPWESA CALPAPSAGV AAAAEAAPPE SECAGLLGCH PVMRELYRMI       180
     ALVARSDATV MILGESGVGK ERVAEAIHRQ SRRAAGPLVR VSCSALNENL LESELFGHVK       240
     GAFTGALRDR RGRFQEAHGG TLLLDEIGDI SPAVQVKLLR VIEQRVVERV GDSQPLPVDV       300
     RLLCATHRDL KQLVTDGRFR ADLYFRLAVF PLRVPPLRER AEDVALLSEG FLARLGAPPP       360
     SPEASRLLAA YAWPGNVREL QNVLEYAALQ AGGAPISPAH LPAEIRGAAP PTPERAAPDR       420
     SAIVEALIRT GWNRARAADV LGISRVTLWK RMKRLGVVGP GPMASGREPL                  470
//

If you have problems or comments...

PBIL Back to PBIL home page