(data stored in ACNUC7421 zone)

EMBL: CP000769.PE9

CP000769.PE9         Location/Qualifiers
FT   CDS             complement(10274..12310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0009"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: ade:Adeh_0008 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24229"
FT                   /db_xref="GOA:A7H683"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A7H683"
FT                   /protein_id="ABS24229.1"
FT                   /translation="MGPFLTAAMLLVGLALFAFTMLGRIVPLLALRRDDRLSRTGERVA
FT                   ALLRYGFGQRRLVDPEERGPGVLHVLVFAAFLVLALRTITLFGMGFTEGFHLPLLGPES
FT                   PLGRVYGFLKDLVLLGALVGVAGFLWRRLVTKPDRVTLSTEGVVILLFIGGLMVTDLLF
FT                   EGSVLLARGEHGSAWEPAGALGRALLAPLAPGPARAIGVLSFWLHLAIILVFLNVLPFG
FT                   KHFHIITGLPNVFFARLSPTGALRKLELEAEDASYGAATVKDLSWKEAWDVYSCTECGR
FT                   CQTHCPTYVTGKPLSHKEVNRTIRHHLLDVAPALAAAARAKEPAAREAALGALPPIASV
FT                   VPPETFWACTTCGWCETACPVLIENVPRLVDMRRQQVLVESSFPDEAARVFKGIETQGN
FT                   PWGIGSNKRAEWCEDLDVPRASSGEPFEWLFFVGCAGAFDDRQKKVSRAIVRILREAKV
FT                   SFAILGEEETCNGEAARRLGNEYLFQLQAQANVETLNGYGVKKILVQCPHCLNTLENEL
FT                   PQFGGRYEVVHHAELIARLVAEGRLTPAAAEGLGTITFHDPCYLARWNGVTEAPREALG
FT                   AVPGLKMVEMPRNRRQGFCCGAGGGRFWLEEKLGTRVNQHRVDEAAATLGEAGGVVATG
FT                   CPFCLTMMKDGVNETGREERLRVMDVAEIVALGLPGARAPREG"
     MGPFLTAAML LVGLALFAFT MLGRIVPLLA LRRDDRLSRT GERVAALLRY GFGQRRLVDP        60
     EERGPGVLHV LVFAAFLVLA LRTITLFGMG FTEGFHLPLL GPESPLGRVY GFLKDLVLLG       120
     ALVGVAGFLW RRLVTKPDRV TLSTEGVVIL LFIGGLMVTD LLFEGSVLLA RGEHGSAWEP       180
     AGALGRALLA PLAPGPARAI GVLSFWLHLA IILVFLNVLP FGKHFHIITG LPNVFFARLS       240
     PTGALRKLEL EAEDASYGAA TVKDLSWKEA WDVYSCTECG RCQTHCPTYV TGKPLSHKEV       300
     NRTIRHHLLD VAPALAAAAR AKEPAAREAA LGALPPIASV VPPETFWACT TCGWCETACP       360
     VLIENVPRLV DMRRQQVLVE SSFPDEAARV FKGIETQGNP WGIGSNKRAE WCEDLDVPRA       420
     SSGEPFEWLF FVGCAGAFDD RQKKVSRAIV RILREAKVSF AILGEEETCN GEAARRLGNE       480
     YLFQLQAQAN VETLNGYGVK KILVQCPHCL NTLENELPQF GGRYEVVHHA ELIARLVAEG       540
     RLTPAAAEGL GTITFHDPCY LARWNGVTEA PREALGAVPG LKMVEMPRNR RQGFCCGAGG       600
     GRFWLEEKLG TRVNQHRVDE AAATLGEAGG VVATGCPFCL TMMKDGVNET GREERLRVMD       660
     VAEIVALGLP GARAPREG                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page