(data stored in ACNUC7421 zone)

EMBL: CP000769.PE91

CP000769.PE91        Location/Qualifiers
FT   CDS             110443..111909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0091"
FT                   /product="protein of unknown function DUF853 NPT hydrolase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF853 NPT
FT                   hydrolase putative; KEGG: ade:Adeh_0089 protein of unknown
FT                   function DUF853, NPT hydrolase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24311"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G5"
FT                   /protein_id="ABS24311.1"
FT                   /translation="MSPPAPLLVAKSTQELLLLPGLANRHGLVAGATGTGKTVTLRVLA
FT                   EGFSRLGVPVFLADVKGDLSGLARPGGDSPKIVERARELGLALAPEASPVVFLDVFGEA
FT                   GHPLRTTISEMGPLLLARVLGLNETQAGVLQVAFRVADEGGLLLLDVKDLRAMLEHLSQ
FT                   QAAELRQRYGNVAPASVGAIQRSLLALEAQGADRLFGEPALALEDLLRTDLGGRGQVTI
FT                   LHAERLVRAPQLYATLLLWLLSELFEQLPEVGDPEKPRLVFFFDEAHLLFDDAPDELRA
FT                   KIEQVVRLVRSKGVGVYFVTQNPLDVPDAVLGQLGNRVQHALRAFTPRDQKAVRAAAET
FT                   FRPNPGLDVEAAITELGVGEALVSFLDAKGTPAPVERALVVPPRSRLAPLTPEERAQVL
FT                   SASPLRGRYDAAVDRESAHELLQKRAAEREAPAREEAPRGRQEPGALGGAGDMLGKMAT
FT                   SAVRAAGTQIGREIMRGILGSMFGGGRRRR"
     MSPPAPLLVA KSTQELLLLP GLANRHGLVA GATGTGKTVT LRVLAEGFSR LGVPVFLADV        60
     KGDLSGLARP GGDSPKIVER ARELGLALAP EASPVVFLDV FGEAGHPLRT TISEMGPLLL       120
     ARVLGLNETQ AGVLQVAFRV ADEGGLLLLD VKDLRAMLEH LSQQAAELRQ RYGNVAPASV       180
     GAIQRSLLAL EAQGADRLFG EPALALEDLL RTDLGGRGQV TILHAERLVR APQLYATLLL       240
     WLLSELFEQL PEVGDPEKPR LVFFFDEAHL LFDDAPDELR AKIEQVVRLV RSKGVGVYFV       300
     TQNPLDVPDA VLGQLGNRVQ HALRAFTPRD QKAVRAAAET FRPNPGLDVE AAITELGVGE       360
     ALVSFLDAKG TPAPVERALV VPPRSRLAPL TPEERAQVLS ASPLRGRYDA AVDRESAHEL       420
     LQKRAAEREA PAREEAPRGR QEPGALGGAG DMLGKMATSA VRAAGTQIGR EIMRGILGSM       480
     FGGGRRRR                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page