(data stored in ACNUC7421 zone)

EMBL: CP000769.PE92

CP000769.PE92        Location/Qualifiers
FT   CDS             complement(111947..112720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0092"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mxa:MXAN_5335 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24312"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G6"
FT                   /protein_id="ABS24312.1"
FT                   /translation="MPQEVVLVVPCYNEAARLDRAELLRLARARDGLALLLVDDGSTDA
FT                   TAAALEELRRAEPARISVLSLARNSGKAEAVRAGLRAALASGAAFTGYADADLSTPVDE
FT                   LLRLVDVAAASSRDAVMGSRVRLLGWRIERRAHRHYLGRVFATFASLALGLPVYDTQCG
FT                   AKLFRATPALAAALEAPFRTRWIFDVELLARLRAGGPGAPPLAAEAFEEVPLRAWRDVG
FT                   GSKLRPGAMLAAGLQLLVLALRLRLRLRLRLGSRR"
     MPQEVVLVVP CYNEAARLDR AELLRLARAR DGLALLLVDD GSTDATAAAL EELRRAEPAR        60
     ISVLSLARNS GKAEAVRAGL RAALASGAAF TGYADADLST PVDELLRLVD VAAASSRDAV       120
     MGSRVRLLGW RIERRAHRHY LGRVFATFAS LALGLPVYDT QCGAKLFRAT PALAAALEAP       180
     FRTRWIFDVE LLARLRAGGP GAPPLAAEAF EEVPLRAWRD VGGSKLRPGA MLAAGLQLLV       240
     LALRLRLRLR LRLGSRR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page