(data stored in ACNUC7421 zone)

EMBL: CP000769.PE93

CP000769.PE93        Location/Qualifiers
FT   CDS             complement(112705..113502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0093"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bch:Bcen2424_1485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24313"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G7"
FT                   /protein_id="ABS24313.1"
FT                   /translation="MRWIPAGFRATVPAMDLVELESGAPVRRHPWEEARLAFFLRVLRG
FT                   AGLLRSRVAVLDVGAGDGFIARRLAEELAPGSTVTCWDANYTAAHLASPAFAPTGRLHF
FT                   TRAAPADAFGLALLLDVLEHVADDLGFLSEVVARRLLPGAHALVSVPAWPALSSSHDEG
FT                   LRHHRRYAPGAARALLAGAGLEVVRGGGLFHALIPPRAAQVALERLRHRPRPPAELGGW
FT                   SAPAPVTALVRGALSLDASLSLLLSRLGIDLPGLSWWALCRKR"
     MRWIPAGFRA TVPAMDLVEL ESGAPVRRHP WEEARLAFFL RVLRGAGLLR SRVAVLDVGA        60
     GDGFIARRLA EELAPGSTVT CWDANYTAAH LASPAFAPTG RLHFTRAAPA DAFGLALLLD       120
     VLEHVADDLG FLSEVVARRL LPGAHALVSV PAWPALSSSH DEGLRHHRRY APGAARALLA       180
     GAGLEVVRGG GLFHALIPPR AAQVALERLR HRPRPPAELG GWSAPAPVTA LVRGALSLDA       240
     SLSLLLSRLG IDLPGLSWWA LCRKR                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page