(data stored in ACNUC7421 zone)

EMBL: CP000769.PE95

CP000769.PE95        Location/Qualifiers
FT   CDS             complement(115040..115528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0095"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   ade:Adeh_0094 protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24315"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6G9"
FT                   /protein_id="ABS24315.1"
FT                   /translation="MPSFDVVSELNLMEVENAFNQARKEILQRFDFKGTSTDLERDKDE
FT                   NVVVKAGSEGRAEAALQVLMEKLAKRGVPLEGLDPQKLEPASGGSVRQLVKLKRGLKQE
FT                   DAKRIVALMKESGLKVQAAIQGEAVRISGKKKDDLQAAMQAIRTGGLGVPLQFQNFRE"
     MPSFDVVSEL NLMEVENAFN QARKEILQRF DFKGTSTDLE RDKDENVVVK AGSEGRAEAA        60
     LQVLMEKLAK RGVPLEGLDP QKLEPASGGS VRQLVKLKRG LKQEDAKRIV ALMKESGLKV       120
     QAAIQGEAVR ISGKKKDDLQ AAMQAIRTGG LGVPLQFQNF RE                          162
//

If you have problems or comments...

PBIL Back to PBIL home page