(data stored in ACNUC7421 zone)

EMBL: CP000769.PE97

CP000769.PE97        Location/Qualifiers
FT   CDS             117655..118596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24317"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H1"
FT                   /protein_id="ABS24317.1"
FT                   /translation="MGRADPKLVRLRFDWPAAAEVQATQRRTRTRTGHAPVTTTTRFTQ
FT                   RLERREGALRISTSGTTWEGDAPYPGPPAAVEGVLRAAERVVQVVSPEGEFRGLEGVEA
FT                   LRPALARVLAGSVPPEQVERALGFAESSMQAQAQEMWNLAVGFWIGADLELGERYGMRT
FT                   EAEVPLAHAEAEFEQEFSVRRRVPCSARDREERCVEVTLRSAPDPAALPALARGVVAQL
FT                   AGGEAPVAAEALRELVVENELLLVTEPARLLPHRVVWTRTVRATAAAGEGAGGEPRLLE
FT                   QVDRHEADYRYDAPRKKPPRKPKRAQPRSASR"
     MGRADPKLVR LRFDWPAAAE VQATQRRTRT RTGHAPVTTT TRFTQRLERR EGALRISTSG        60
     TTWEGDAPYP GPPAAVEGVL RAAERVVQVV SPEGEFRGLE GVEALRPALA RVLAGSVPPE       120
     QVERALGFAE SSMQAQAQEM WNLAVGFWIG ADLELGERYG MRTEAEVPLA HAEAEFEQEF       180
     SVRRRVPCSA RDREERCVEV TLRSAPDPAA LPALARGVVA QLAGGEAPVA AEALRELVVE       240
     NELLLVTEPA RLLPHRVVWT RTVRATAAAG EGAGGEPRLL EQVDRHEADY RYDAPRKKPP       300
     RKPKRAQPRS ASR                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page