(data stored in ACNUC7421 zone)

EMBL: CP000769.PE99

CP000769.PE99        Location/Qualifiers
FT   CDS             complement(121028..122860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0099"
FT                   /product="Spore coat protein CotH"
FT                   /note="PFAM: Spore coat protein CotH; KEGG: ade:Adeh_3317
FT                   spore coat assembly protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24319"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H3"
FT                   /protein_id="ABS24319.1"
FT                   /translation="MVLPAGGLPVRPRRIARCPVNRQAPFLVAAILSLACGRGDGTTVV
FT                   RPPDEQPPPYQPPQQQLPPPGPSWPVASAPGAFPTPEPRLRRVDLTLAPGDLAALEAEP
FT                   TWDVMYPATVALDGRAAEGLVRFRGASSRTRPQRSWRIDLDPGYALEGRDRFALLAEYD
FT                   DAAKLVERFAVDLYRALGLPVPFARYVKLYVNGAYRGVFLDMERVGGEYLVHHGHETDA
FT                   SLYRCGGRNCELKLLPRYEPAYQQDFTKTRNEALPWDDLDRLLETVSRTDDAELERRLG
FT                   EVMDLDAYLGNLAADELIANTVLEDARGYWLHELHRDVWTYVPWDLNNSQAYWSRDIAA
FT                   NAPLGGVWREAQIFSIYDDAVRRIYDVRVTERAGQKPTWSVLATRVWDHPALRARLLAK
FT                   LEAALAGPFTPERVGPYLEALWAAAGPEIVTDPFVDATRAQTVPSRLVTFVRDRRSVLL
FT                   GRLARLRAHGSGPLVVNEVGMPGGTGPGYVELYNRADVALDLSGAHVTDDLRAPGKYAL
FT                   PEGTTIPPRGHLLLVADGTPWPPPAGAPAGEPLRLPFVLSPAGGELGVFAPGTLHAPYD
FT                   LVYFGPRAEGGAYGRTGDGVEAWSDVARTPGAPN"
     MVLPAGGLPV RPRRIARCPV NRQAPFLVAA ILSLACGRGD GTTVVRPPDE QPPPYQPPQQ        60
     QLPPPGPSWP VASAPGAFPT PEPRLRRVDL TLAPGDLAAL EAEPTWDVMY PATVALDGRA       120
     AEGLVRFRGA SSRTRPQRSW RIDLDPGYAL EGRDRFALLA EYDDAAKLVE RFAVDLYRAL       180
     GLPVPFARYV KLYVNGAYRG VFLDMERVGG EYLVHHGHET DASLYRCGGR NCELKLLPRY       240
     EPAYQQDFTK TRNEALPWDD LDRLLETVSR TDDAELERRL GEVMDLDAYL GNLAADELIA       300
     NTVLEDARGY WLHELHRDVW TYVPWDLNNS QAYWSRDIAA NAPLGGVWRE AQIFSIYDDA       360
     VRRIYDVRVT ERAGQKPTWS VLATRVWDHP ALRARLLAKL EAALAGPFTP ERVGPYLEAL       420
     WAAAGPEIVT DPFVDATRAQ TVPSRLVTFV RDRRSVLLGR LARLRAHGSG PLVVNEVGMP       480
     GGTGPGYVEL YNRADVALDL SGAHVTDDLR APGKYALPEG TTIPPRGHLL LVADGTPWPP       540
     PAGAPAGEPL RLPFVLSPAG GELGVFAPGT LHAPYDLVYF GPRAEGGAYG RTGDGVEAWS       600
     DVARTPGAPN                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page