(data stored in ACNUC7421 zone)

EMBL: CP000820.PE1

CP000820.PE1         Location/Qualifiers
FT   CDS             71..1654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: fal:FRAAL0002 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09470"
FT                   /db_xref="GOA:A8LB16"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB16"
FT                   /protein_id="ABW09470.1"
FT                   /translation="MTDLSADSVAGQPSRGAAPTSEPDLSAVWEQAVAGVADGTLSGQQ
FT                   RAWLRLTRPLGLVQDTALLAAPNEFTKDLLDSRLRPFLSTALSTAYGREIRVAVTVEHT
FT                   PDPEPMTGPLTLPGTDPGGGPRSLLGTGHEPRPGEEHRGEDRRNEDRLDGRLEGRVDGA
FT                   PPGRMAPGLGRDPSPRPSEPARLNPRYLFETFVIGDSNRFPHAAAVAVAEAPAKAYNPL
FT                   FIYGDSGLGKTHLLHAIGHYTVKLYPESKIKYVSMEEFTNDFIASIRDDRQLAFQRRYR
FT                   DIDVLLVDDIQFLENKERTQEEFFHTFNVLHDTEKQIVISSDRSPKQLSALEDRLRSRF
FT                   EWGLITDVTPPDLETRIAILSKKAATERLPVPPDVLEYIATHIERNIRELEGALIRVAA
FT                   FASLNKSHVDRTLAEIVLRDLIPDAANPEITAAAIMNATAAYFGVSMEDLCGTSRSRVL
FT                   VTARQIAMYLCRELTDLSLPKIGQHFGGRDHTTVMHADRKIRGLMAERRAIYNQVTELT
FT                   NRIRAQARHA"
     MTDLSADSVA GQPSRGAAPT SEPDLSAVWE QAVAGVADGT LSGQQRAWLR LTRPLGLVQD        60
     TALLAAPNEF TKDLLDSRLR PFLSTALSTA YGREIRVAVT VEHTPDPEPM TGPLTLPGTD       120
     PGGGPRSLLG TGHEPRPGEE HRGEDRRNED RLDGRLEGRV DGAPPGRMAP GLGRDPSPRP       180
     SEPARLNPRY LFETFVIGDS NRFPHAAAVA VAEAPAKAYN PLFIYGDSGL GKTHLLHAIG       240
     HYTVKLYPES KIKYVSMEEF TNDFIASIRD DRQLAFQRRY RDIDVLLVDD IQFLENKERT       300
     QEEFFHTFNV LHDTEKQIVI SSDRSPKQLS ALEDRLRSRF EWGLITDVTP PDLETRIAIL       360
     SKKAATERLP VPPDVLEYIA THIERNIREL EGALIRVAAF ASLNKSHVDR TLAEIVLRDL       420
     IPDAANPEIT AAAIMNATAA YFGVSMEDLC GTSRSRVLVT ARQIAMYLCR ELTDLSLPKI       480
     GQHFGGRDHT TVMHADRKIR GLMAERRAIY NQVTELTNRI RAQARHA                     527
//

If you have problems or comments...

PBIL Back to PBIL home page