(data stored in ACNUC7421 zone)

EMBL: CP000820.PE10

CP000820.PE10        Location/Qualifiers
FT   CDS             complement(15821..17065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09479"
FT                   /db_xref="GOA:A8LB25"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB25"
FT                   /protein_id="ABW09479.1"
FT                   /translation="MRPGESATGASLLSPEALRATADAIAAAQEPDGAIPWFAGGHTDP
FT                   WDHLECAMALLVTGRVDAADAAWDWLHRRQRPDGSWATSHVGGAVKEDFADSNQCAYVA
FT                   TALWHRWLVTGDRAFVTRMWPVARAALDFVVDMQAPGGQIWWARTPTGEDYPEALVTGC
FT                   SSTLHSLRCGLGLAALVGEARPEWEVAAGALWHALRRHPEYFMPRDRWSMDWYYPVIGG
FT                   ALRGAEGRARLRSRWDEFVVPGLGIRCVDDEPWVTGAETCELAIALHLVGETEAAAGLV
FT                   REMQHLRAPNGAYWTGWQFADGCHWPEEQSTWTAAAVVLAVDALAGGPTERTFRGDDLP
FT                   EGLHVVHRDDLPEPRDPSTPRTGRGTAGERAPCGERRAGGLATPGRGGEALTGPWRACG
FT                   CDSEEPAEDPQRSRA"
     MRPGESATGA SLLSPEALRA TADAIAAAQE PDGAIPWFAG GHTDPWDHLE CAMALLVTGR        60
     VDAADAAWDW LHRRQRPDGS WATSHVGGAV KEDFADSNQC AYVATALWHR WLVTGDRAFV       120
     TRMWPVARAA LDFVVDMQAP GGQIWWARTP TGEDYPEALV TGCSSTLHSL RCGLGLAALV       180
     GEARPEWEVA AGALWHALRR HPEYFMPRDR WSMDWYYPVI GGALRGAEGR ARLRSRWDEF       240
     VVPGLGIRCV DDEPWVTGAE TCELAIALHL VGETEAAAGL VREMQHLRAP NGAYWTGWQF       300
     ADGCHWPEEQ STWTAAAVVL AVDALAGGPT ERTFRGDDLP EGLHVVHRDD LPEPRDPSTP       360
     RTGRGTAGER APCGERRAGG LATPGRGGEA LTGPWRACGC DSEEPAEDPQ RSRA             414
//

If you have problems or comments...

PBIL Back to PBIL home page