(data stored in ACNUC7421 zone)

EMBL: CP000820.PE100

CP000820.PE100       Location/Qualifiers
FT   CDS             121434..122270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0102"
FT                   /product="putative undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: pac:PPA2224 undecaprenyl-diphosphatase;
FT                   TIGRFAM: putative undecaprenol kinase; PFAM: Bacitracin
FT                   resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09569"
FT                   /db_xref="GOA:A8LBA8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA8"
FT                   /protein_id="ABW09569.1"
FT                   /translation="MNIVEAVFLGAVEGLTEFLPVSSTGHLTIIEKLLGYSIDDPDITA
FT                   FTAIIQVGAVFATLLYLRHDFRRIIAALARGVTRPEYRDHPDFRFGVAVIVGSIPIGIV
FT                   GLLFKDQIETTLRSLWFVGTALIGWSAVMGYADRVATQKRHEDDVTWKDTLVIGVVQCM
FT                   ALIPGISRSGSTMSAGLLRGIDRVTVTRLSFFLSIPALFAAALLQVVTESSNIEQGVGW
FT                   TVTITATVVSFVTAYFAIAWLLKFVARHSYSVFIYYRLALGSVILFLLATGIISAT"
     MNIVEAVFLG AVEGLTEFLP VSSTGHLTII EKLLGYSIDD PDITAFTAII QVGAVFATLL        60
     YLRHDFRRII AALARGVTRP EYRDHPDFRF GVAVIVGSIP IGIVGLLFKD QIETTLRSLW       120
     FVGTALIGWS AVMGYADRVA TQKRHEDDVT WKDTLVIGVV QCMALIPGIS RSGSTMSAGL       180
     LRGIDRVTVT RLSFFLSIPA LFAAALLQVV TESSNIEQGV GWTVTITATV VSFVTAYFAI       240
     AWLLKFVARH SYSVFIYYRL ALGSVILFLL ATGIISAT                               278
//

If you have problems or comments...

PBIL Back to PBIL home page