(data stored in ACNUC7421 zone)

EMBL: CP000820.PE101

CP000820.PE101       Location/Qualifiers
FT   CDS             122399..123010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0103"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: fal:FRAAL6787
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09570"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA9"
FT                   /protein_id="ABW09570.1"
FT                   /translation="MTSTVQESIDVAVPVRTAYNQWTQFESFPNFMEGVESIQQTDDTH
FT                   THWRIKAGGTEREFDATITEQLPDERVAWKSTEGSRHAGVVTFHRLADDATRVTVQMDW
FT                   QPEGLVEKAGSVLGADDRRVKDDLKRFKSFIEERGQETGAWRGDVSRPDAAGQSGQSGQ
FT                   SGQPGRLGSSEAPGTGGAGGPQRDQGTGGATYSQPGGGEF"
     MTSTVQESID VAVPVRTAYN QWTQFESFPN FMEGVESIQQ TDDTHTHWRI KAGGTEREFD        60
     ATITEQLPDE RVAWKSTEGS RHAGVVTFHR LADDATRVTV QMDWQPEGLV EKAGSVLGAD       120
     DRRVKDDLKR FKSFIEERGQ ETGAWRGDVS RPDAAGQSGQ SGQSGQPGRL GSSEAPGTGG       180
     AGGPQRDQGT GGATYSQPGG GEF                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page