(data stored in ACNUC7421 zone)

EMBL: CP000820.PE107

CP000820.PE107       Location/Qualifiers
FT   CDS             complement(127540..128625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0109"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; KEGG:
FT                   fal:FRAAL6784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09576"
FT                   /db_xref="GOA:A8LCD7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCD7"
FT                   /protein_id="ABW09576.1"
FT                   /translation="MYGSSWDRTRNTESTAWGRPPGRRPRAAAGHPDTTQTRRGTRDSS
FT                   RPTATGTSSADRDPSTGGDPSAGRGPKAGRDPTADGVRARGEHERPGLTVAVTLYPPAR
FT                   NRPVRNTSGTMVEPTRGLIPHVQVGTGSLFGWFDNPASQVSAHLWLSKAGEFEQYVPFD
FT                   RRAWAQAAGNPFWISVECEGYDSEDYTAIQVQRLGELFAWGMREFGWRPEITDSPNGYG
FT                   LGTHRMGGAAWGGHSCPGNVRANRRGDILAAALGASPGGSLADPRQRYAGMPTLREGMS
FT                   GPEVVTLQNALNIIFGHEAPTGDPYRLAPDGAYGARTTARVASLQRYATPWFGRIPEDG
FT                   VCGPNTWRKIGYVLTGMNRQV"
     MYGSSWDRTR NTESTAWGRP PGRRPRAAAG HPDTTQTRRG TRDSSRPTAT GTSSADRDPS        60
     TGGDPSAGRG PKAGRDPTAD GVRARGEHER PGLTVAVTLY PPARNRPVRN TSGTMVEPTR       120
     GLIPHVQVGT GSLFGWFDNP ASQVSAHLWL SKAGEFEQYV PFDRRAWAQA AGNPFWISVE       180
     CEGYDSEDYT AIQVQRLGEL FAWGMREFGW RPEITDSPNG YGLGTHRMGG AAWGGHSCPG       240
     NVRANRRGDI LAAALGASPG GSLADPRQRY AGMPTLREGM SGPEVVTLQN ALNIIFGHEA       300
     PTGDPYRLAP DGAYGARTTA RVASLQRYAT PWFGRIPEDG VCGPNTWRKI GYVLTGMNRQ       360
     V                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page