(data stored in ACNUC7421 zone)

EMBL: CP000820.PE109

CP000820.PE109       Location/Qualifiers
FT   CDS             129761..130477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0111"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6782 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09578"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCD9"
FT                   /protein_id="ABW09578.1"
FT                   /translation="MTVARSFSVGRAGLVAVLIAGTFAITGQTAARAGGTPGAECPGGQ
FT                   EFEVAVTGDEPDPGPPVRLEAGYYAHTASFWPPRSAVLCRTESGTDQPSAQVTDTPGLT
FT                   CPAGASELVVPDVIPTDIETPVVADSGALLPAGWYSLPSLDPESAPASTQPTDLPDQAG
FT                   PAGPVTPVNQPGPGQTALTSPGATGPESTSPATGGGVTEAGAFTGGGTAPDGDGAGTVV
FT                   WTTLCWSQTDPGAPAA"
     MTVARSFSVG RAGLVAVLIA GTFAITGQTA ARAGGTPGAE CPGGQEFEVA VTGDEPDPGP        60
     PVRLEAGYYA HTASFWPPRS AVLCRTESGT DQPSAQVTDT PGLTCPAGAS ELVVPDVIPT       120
     DIETPVVADS GALLPAGWYS LPSLDPESAP ASTQPTDLPD QAGPAGPVTP VNQPGPGQTA       180
     LTSPGATGPE STSPATGGGV TEAGAFTGGG TAPDGDGAGT VVWTTLCWSQ TDPGAPAA         238
//

If you have problems or comments...

PBIL Back to PBIL home page