(data stored in ACNUC7421 zone)

EMBL: CP000820.PE111

CP000820.PE111       Location/Qualifiers
FT   CDS             complement(132262..134859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0113"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: fal:FRAAL6779
FT                   hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09580"
FT                   /db_xref="GOA:A8LCE1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE1"
FT                   /protein_id="ABW09580.1"
FT                   /translation="MPSSPAPSDPSAPSGGSARFWSGLGRTVGRRTGMVAVVALIITAV
FT                   LGLGLTKLEFTTGQDNYLNSDSQVAKDNVAYQNLFGGQAMIVLFTTKPGTDLVDLFTTD
FT                   NVKKFRDLSARLEKDPRIESVITPLTALQFTANLVTSPDGNPISSPAGQILLDAQSRDP
FT                   NPDSAKRRLADSLRTLERINAIPADRRDFDDPDWTDFLLHDNTGAVRKSLESFFPTDRT
FT                   AQMIVRLKGNASIKEEGRGASATEAAMQDLTFDNADVMTTGAAVLLRDINDYLRGGFLT
FT                   LGAISLVIMAGLLLVAFAVRWRLLPLGVVAVGLVWAFGLAGYLGVPLSVVTIAGMPVLL
FT                   GVGIDFAVQLHSRVEEEAQLDRARDPVAEALAWLMPALAVATVAGIVAFLALEFSEVPM
FT                   IRDFGVLLAIGLPVIVVATVLLSAASLGFRERRSPTAPRDYSRGPLGRAVVALGSLPRV
FT                   TAIPLVVLAAAIFAGGLVVEGDLKVQTDPEKWVSQDSQVVHDIQNLKAQTGSSSELGVY
FT                   IQSGDVFDDRTVKFVHDFTYQQLKEHPQELLTASSLVTTISFLMEVPDTTLLAPTGADI
FT                   ERAYRVTPEAIQKSTVNLDGKALNLIFRTGPGALEERAVVVDDIRATVSPPEGIRATPS
FT                   GLAVVGTGLLENFEKNRVELTYFALIGVFLILLLWHRNIVRAVVSVVPVLIAVGLTAIV
FT                   SWLAGFDLSPLTAVGGPLVIALCTEFTTLIVMRHIEERRRGRDPLAAIEEAAARTGRAF
FT                   MVSALAAVIGIVVLAFSSLPLLRDFGLVVALNVGVALLSALVVLPPLLLWADERGWVYR
FT                   GPRLAAGALPLPTPAPAGAGVGGPAGSDGTSAPPAGSATPPAAGSSAGPTPES"
     MPSSPAPSDP SAPSGGSARF WSGLGRTVGR RTGMVAVVAL IITAVLGLGL TKLEFTTGQD        60
     NYLNSDSQVA KDNVAYQNLF GGQAMIVLFT TKPGTDLVDL FTTDNVKKFR DLSARLEKDP       120
     RIESVITPLT ALQFTANLVT SPDGNPISSP AGQILLDAQS RDPNPDSAKR RLADSLRTLE       180
     RINAIPADRR DFDDPDWTDF LLHDNTGAVR KSLESFFPTD RTAQMIVRLK GNASIKEEGR       240
     GASATEAAMQ DLTFDNADVM TTGAAVLLRD INDYLRGGFL TLGAISLVIM AGLLLVAFAV       300
     RWRLLPLGVV AVGLVWAFGL AGYLGVPLSV VTIAGMPVLL GVGIDFAVQL HSRVEEEAQL       360
     DRARDPVAEA LAWLMPALAV ATVAGIVAFL ALEFSEVPMI RDFGVLLAIG LPVIVVATVL       420
     LSAASLGFRE RRSPTAPRDY SRGPLGRAVV ALGSLPRVTA IPLVVLAAAI FAGGLVVEGD       480
     LKVQTDPEKW VSQDSQVVHD IQNLKAQTGS SSELGVYIQS GDVFDDRTVK FVHDFTYQQL       540
     KEHPQELLTA SSLVTTISFL MEVPDTTLLA PTGADIERAY RVTPEAIQKS TVNLDGKALN       600
     LIFRTGPGAL EERAVVVDDI RATVSPPEGI RATPSGLAVV GTGLLENFEK NRVELTYFAL       660
     IGVFLILLLW HRNIVRAVVS VVPVLIAVGL TAIVSWLAGF DLSPLTAVGG PLVIALCTEF       720
     TTLIVMRHIE ERRRGRDPLA AIEEAAARTG RAFMVSALAA VIGIVVLAFS SLPLLRDFGL       780
     VVALNVGVAL LSALVVLPPL LLWADERGWV YRGPRLAAGA LPLPTPAPAG AGVGGPAGSD       840
     GTSAPPAGSA TPPAAGSSAG PTPES                                             865
//

If you have problems or comments...

PBIL Back to PBIL home page