(data stored in ACNUC7421 zone)

EMBL: CP000820.PE112

CP000820.PE112       Location/Qualifiers
FT   CDS             complement(135288..135494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0114"
FT                   /product="Domain of unknown function DUF1918"
FT                   /note="PFAM: Domain of unknown function DUF1918; KEGG:
FT                   fal:FRAAL6778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09581"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE2"
FT                   /protein_id="ABW09581.1"
FT                   /translation="MYASVGDRFVVHGRTVGCPERHGVITEVRGVAGGPPYLVRWDDGH
FT                   EGLFFPGADSTIELRPAREHARA"
     MYASVGDRFV VHGRTVGCPE RHGVITEVRG VAGGPPYLVR WDDGHEGLFF PGADSTIELR        60
     PAREHARA                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page