(data stored in ACNUC7421 zone)

EMBL: CP000820.PE117

CP000820.PE117       Location/Qualifiers
FT   CDS             complement(141971..142558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09586"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE7"
FT                   /protein_id="ABW09586.1"
FT                   /translation="MSDRFIGHLARNSGRALPGARRSPPERAGCRMHLCHLSQAAPAAP
FT                   GTPAGRQRYAGLRPLTYVTPPPAATRRGRPPPTHVQNTAPSPRRVTAKSPGAPTIGGDL
FT                   DARTQSIQRAHTGRGENHPCQSGMIGTTRLGPPAPSQTAHSEATLRPRRMIRSNFLCCA
FT                   EVKKISRITTLRIFIRNHRHTSESGSTQKSDN"
     MSDRFIGHLA RNSGRALPGA RRSPPERAGC RMHLCHLSQA APAAPGTPAG RQRYAGLRPL        60
     TYVTPPPAAT RRGRPPPTHV QNTAPSPRRV TAKSPGAPTI GGDLDARTQS IQRAHTGRGE       120
     NHPCQSGMIG TTRLGPPAPS QTAHSEATLR PRRMIRSNFL CCAEVKKISR ITTLRIFIRN       180
     HRHTSESGST QKSDN                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page