(data stored in ACNUC7421 zone)

EMBL: CP000820.PE123

CP000820.PE123       Location/Qualifiers
FT   CDS             149587..150732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0125"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: fal:FRAAL6764
FT                   hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09592"
FT                   /db_xref="GOA:A8LCF3"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF3"
FT                   /protein_id="ABW09592.1"
FT                   /translation="MTDSPAGDPARAPEGSSGAPGGSGGAGSAGEAEIPRPASPLPAAG
FT                   EPPPAGGPPNGGPPNGGPASGGPPHEQVGWRPETGPPAGHAGWTPPPAGAPSLPHCYRH
FT                   PERETYVTCQRCGRPICPDCMRPAAVGFHCPEESGAGGGGRPERRREPRTDFGGRPGAG
FT                   RRGLVTQVLISLCLVAFVLQGLPGLARDSGSLNQFSADFRLYGVSLAWDDQYYRLLTAA
FT                   FLHVNYLHVLVNLYALFVLGYQLEAILGRLRLVALFVACAVGGNTLSYLVNGVSVNSVG
FT                   ASTAIFGFFGAYYVIARRLRADTTQILILIGINFALTFTLSFIDRWGHVGGLVAGVLVG
FT                   LLYAYVPPRRTVVQAAGVLALVGLLFAAAVIKSADLTTAFA"
     MTDSPAGDPA RAPEGSSGAP GGSGGAGSAG EAEIPRPASP LPAAGEPPPA GGPPNGGPPN        60
     GGPASGGPPH EQVGWRPETG PPAGHAGWTP PPAGAPSLPH CYRHPERETY VTCQRCGRPI       120
     CPDCMRPAAV GFHCPEESGA GGGGRPERRR EPRTDFGGRP GAGRRGLVTQ VLISLCLVAF       180
     VLQGLPGLAR DSGSLNQFSA DFRLYGVSLA WDDQYYRLLT AAFLHVNYLH VLVNLYALFV       240
     LGYQLEAILG RLRLVALFVA CAVGGNTLSY LVNGVSVNSV GASTAIFGFF GAYYVIARRL       300
     RADTTQILIL IGINFALTFT LSFIDRWGHV GGLVAGVLVG LLYAYVPPRR TVVQAAGVLA       360
     LVGLLFAAAV IKSADLTTAF A                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page