(data stored in ACNUC7421 zone)

EMBL: CP000820.PE124

CP000820.PE124       Location/Qualifiers
FT   CDS             complement(150756..151208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09593"
FT                   /db_xref="GOA:A8LCF4"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF4"
FT                   /protein_id="ABW09593.1"
FT                   /translation="MSTPPVDLSWSPPIWRCAAYAAGGAVLLVVAAVEDLAWRVASLDG
FT                   AGRLLVGLVGLGLVALAVSDAVSRPTLRLGPGGIDYVEGLRRRHLPWAAVIGARSGTLT
FT                   HGRRLVHLRTLEIETIDGPVLLSRRALGTDPERVAEAVEELRLRLG"
     MSTPPVDLSW SPPIWRCAAY AAGGAVLLVV AAVEDLAWRV ASLDGAGRLL VGLVGLGLVA        60
     LAVSDAVSRP TLRLGPGGID YVEGLRRRHL PWAAVIGARS GTLTHGRRLV HLRTLEIETI       120
     DGPVLLSRRA LGTDPERVAE AVEELRLRLG                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page