(data stored in ACNUC7421 zone)

EMBL: CP000820.PE128

CP000820.PE128       Location/Qualifiers
FT   CDS             155425..157335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0130"
FT                   /product="glycoside hydrolase 15-related"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   fal:FRAAL6761 conserved hypothetical protein; putative
FT                   glycosyl hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09597"
FT                   /db_xref="GOA:A8LCF8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF8"
FT                   /protein_id="ABW09597.1"
FT                   /translation="MAHTPTRRGGGSPFPPIAEYGFLSDCETNCLVAPSGNVEWMCVPR
FT                   PDAPSVFGAVLDRSAGGFRFGPDRTFIPAGRRYLPGTNVLETTWQTPTGWLIVTDCLVV
FT                   GRWHRTHRRSKTHRRTPGDWDADHVLLRLARCEHGDVDLSLVCEPNFDYGRSPASWRYE
FT                   DEDYSTGIITHDFPAGDPAAGVALRLRTDLRLGFDGRRALARTTLREGDTAFVAMTWRA
FT                   EDPLLPGNYPQACAAVDSTTEFWRQWLSRGRFPDHPWRRHLQRSALALKGLTYAPTGAL
FT                   LAAATTSLPETPQGERNWDYRYSWIRDSTFALWGLYTLGLDYEANDFFSFIADVAEHAD
FT                   DIQVMYRVGGEPKIDEEILGHLSGYDGAVPVRVGNEAAKQRQHDVWGAVLDSVYLHTRS
FT                   RDYLSERLWPVLVRLVEAAAAHWRETDRGMWEVRGEPRHFTSSKMFCWVALDRGRRLAQ
FT                   MRGDLRTAGRWDDIADEIHADVLANGVDHRGVFTQYYGSTSLDASVLLMPLLGFLPSTD
FT                   DRVKATVLAIADELTVDGLVLRYRTDETDDGVEGEEGAFLICSFWLVSALVEIGELTRA
FT                   RQLCERLLSLASPLDLYAEEIDPADGRHLGNFPQAFTHLALINAVMYVIRAESGESFTR
FT                   S"
     MAHTPTRRGG GSPFPPIAEY GFLSDCETNC LVAPSGNVEW MCVPRPDAPS VFGAVLDRSA        60
     GGFRFGPDRT FIPAGRRYLP GTNVLETTWQ TPTGWLIVTD CLVVGRWHRT HRRSKTHRRT       120
     PGDWDADHVL LRLARCEHGD VDLSLVCEPN FDYGRSPASW RYEDEDYSTG IITHDFPAGD       180
     PAAGVALRLR TDLRLGFDGR RALARTTLRE GDTAFVAMTW RAEDPLLPGN YPQACAAVDS       240
     TTEFWRQWLS RGRFPDHPWR RHLQRSALAL KGLTYAPTGA LLAAATTSLP ETPQGERNWD       300
     YRYSWIRDST FALWGLYTLG LDYEANDFFS FIADVAEHAD DIQVMYRVGG EPKIDEEILG       360
     HLSGYDGAVP VRVGNEAAKQ RQHDVWGAVL DSVYLHTRSR DYLSERLWPV LVRLVEAAAA       420
     HWRETDRGMW EVRGEPRHFT SSKMFCWVAL DRGRRLAQMR GDLRTAGRWD DIADEIHADV       480
     LANGVDHRGV FTQYYGSTSL DASVLLMPLL GFLPSTDDRV KATVLAIADE LTVDGLVLRY       540
     RTDETDDGVE GEEGAFLICS FWLVSALVEI GELTRARQLC ERLLSLASPL DLYAEEIDPA       600
     DGRHLGNFPQ AFTHLALINA VMYVIRAESG ESFTRS                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page