(data stored in ACNUC7421 zone)

EMBL: CP000820.PE129

CP000820.PE129       Location/Qualifiers
FT   CDS             complement(157556..157822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0131"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   sco:SCO3854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09598"
FT                   /db_xref="GOA:A8LCF9"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF9"
FT                   /protein_id="ABW09598.1"
FT                   /translation="MPESRRRKPKKTTVAAPQTSTRAPKRRPPSPPWFGGMILAFFLIG
FT                   IAYLLVYYFSNGGVLGMESLGGWNILIGFGFVVVGLAVSTQWR"
     MPESRRRKPK KTTVAAPQTS TRAPKRRPPS PPWFGGMILA FFLIGIAYLL VYYFSNGGVL        60
     GMESLGGWNI LIGFGFVVVG LAVSTQWR                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page