(data stored in ACNUC7421 zone)

EMBL: CP000820.PE13

CP000820.PE13        Location/Qualifiers
FT   CDS             complement(19531..19959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0013"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: fal:FRAAL0026
FT                   putative organic hydroperoxide resistance protein
FT                   (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09482"
FT                   /db_xref="GOA:A8LB28"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB28"
FT                   /protein_id="ABW09482.1"
FT                   /translation="MAAPLYTATSTAWGGRDGRVVSNDNRIDLQLSMPKGLGGDDGPGT
FT                   NPEQLFATGYAACFHGALKAVARERKIDVTDSAVTVSVSISRTDEGLDLSTRIEAQIPG
FT                   VDPATGRELLDLAHAKCPYSRATRGNIAAEVTLVDGDS"
     MAAPLYTATS TAWGGRDGRV VSNDNRIDLQ LSMPKGLGGD DGPGTNPEQL FATGYAACFH        60
     GALKAVARER KIDVTDSAVT VSVSISRTDE GLDLSTRIEA QIPGVDPATG RELLDLAHAK       120
     CPYSRATRGN IAAEVTLVDG DS                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page