(data stored in ACNUC7421 zone)

EMBL: CP000820.PE131

CP000820.PE131       Location/Qualifiers
FT   CDS             159068..159718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0133"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   fal:FRAAL6756 aminodeoxychorismate synthase subunit II,
FT                   component of p-aminobenzoate synthase multienzyme complex"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09600"
FT                   /db_xref="GOA:A8LCG1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG1"
FT                   /protein_id="ABW09600.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLDTECVVRRNDEVDPGDLDELGA
FT                   DGVLLSPGPGTPEAAGVSIAMVHACAARRLPLFGVCLGHQALGVAHGATVDRAPELLHG
FT                   KTSVVHHEGVGVLADLPSPFTATRYHSLAVEESTLPAEIEVTARTDSGVVMAMRHRELP
FT                   LEGVQFHPESVLTQGGHLMLARWLEICGDGGAAMRLAPALAAEVETLRLAAFA"
     MRILVVDNYD SFVFNLVQYL GQLDTECVVR RNDEVDPGDL DELGADGVLL SPGPGTPEAA        60
     GVSIAMVHAC AARRLPLFGV CLGHQALGVA HGATVDRAPE LLHGKTSVVH HEGVGVLADL       120
     PSPFTATRYH SLAVEESTLP AEIEVTARTD SGVVMAMRHR ELPLEGVQFH PESVLTQGGH       180
     LMLARWLEIC GDGGAAMRLA PALAAEVETL RLAAFA                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page