(data stored in ACNUC7421 zone)

EMBL: CP000820.PE133

CP000820.PE133       Location/Qualifiers
FT   CDS             complement(161876..163555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0135"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   fal:FRAAL6754 serine/threonine-protein kinase PknA (partial
FT                   match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09602"
FT                   /db_xref="GOA:A8LCG3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG3"
FT                   /protein_id="ABW09602.1"
FT                   /translation="MSTSANSPSPSQPFAGAASPNTVLDNRYRLDGRIATGGMGEVWRG
FT                   LDQTLGRPVAVKLLRPEYASDESFLVRFRGEARHAARLSHPGVASVYDYGEVSTADDYP
FT                   TAYLVMELVEGEPLSALLHREKRLSPDRMLDILGQSADALQAAHALGVVHRDVKPGNLL
FT                   LRTDGAVKVTDFGIARAVDAAPLTATGIMMGTAYYVSPEQASGRPVTPASDVYSLGVVA
FT                   YECLAGRRPFDDRNPIVVVMAHQQDTPPPLPSDIPYQVRALVESAMSKDASRRPSSAGA
FT                   FARSAASIRRSLWNSDAGRWSGTPGAADATARHPAPPAPPHLGPVPPRAPTAPRTPSWN
FT                   RSGGASWTQQPPPADPTAAAPGMPATALQPSPGQGGSGPGAGRGGGPGRLYGSGDYPPD
FT                   PRNPSDYRNPSDYRNDYPPGGEHGPGWHGGRDDGGHRDGSGHRDGGPGDPANTLYQPSP
FT                   SWSDPPGDGPGGRVAHRRPGAAAQRRRLPLPVLIALLILTVLVVAVITRTVAEAGGSKD
FT                   GAAATSNVLYLTPAEGEIVGPAGEAAGTVVAGAAEPTTGDNL"
     MSTSANSPSP SQPFAGAASP NTVLDNRYRL DGRIATGGMG EVWRGLDQTL GRPVAVKLLR        60
     PEYASDESFL VRFRGEARHA ARLSHPGVAS VYDYGEVSTA DDYPTAYLVM ELVEGEPLSA       120
     LLHREKRLSP DRMLDILGQS ADALQAAHAL GVVHRDVKPG NLLLRTDGAV KVTDFGIARA       180
     VDAAPLTATG IMMGTAYYVS PEQASGRPVT PASDVYSLGV VAYECLAGRR PFDDRNPIVV       240
     VMAHQQDTPP PLPSDIPYQV RALVESAMSK DASRRPSSAG AFARSAASIR RSLWNSDAGR       300
     WSGTPGAADA TARHPAPPAP PHLGPVPPRA PTAPRTPSWN RSGGASWTQQ PPPADPTAAA       360
     PGMPATALQP SPGQGGSGPG AGRGGGPGRL YGSGDYPPDP RNPSDYRNPS DYRNDYPPGG       420
     EHGPGWHGGR DDGGHRDGSG HRDGGPGDPA NTLYQPSPSW SDPPGDGPGG RVAHRRPGAA       480
     AQRRRLPLPV LIALLILTVL VVAVITRTVA EAGGSKDGAA ATSNVLYLTP AEGEIVGPAG       540
     EAAGTVVAGA AEPTTGDNL                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page