(data stored in ACNUC7421 zone)

EMBL: CP000820.PE138

CP000820.PE138       Location/Qualifiers
FT   CDS             complement(168435..170036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0140"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   fal:FRAAL6749 hypothetical protein; putative FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09607"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG8"
FT                   /protein_id="ABW09607.1"
FT                   /translation="MGVLQRFERRLGGLVEGAFAKVFKGGVEPVEIASALARETDDRRA
FT                   SSSNRVLVPNEFAVELAGGDFARLAPYTRALCDELAEMVREHAAEQRYTFVGPVTVRLA
FT                   EAADLDIGVFRIRSSVASADPAVVGGRRPRPRPAAPGTPHLLITTRAPGGSGSGEREYP
FT                   LDAETTVIGRSVECDIRLNDTGVSRRHGEIRRLPDGQFLYVDAGSTNGSLVNGRAATQV
FT                   KLVNGDRIELGTAVVEFRREEARGATGPRGPRTPVPARSSPPPGRPTPPPADHRTPPPF
FT                   DPRQPTPSTRRGTPSPDDRYARPEPGVPGGPGGREPGYRDRPGRDPRDGDYREGPSPRF
FT                   RDDPPGRPAGDHRPDAYREGPSPRFRDEPGAPPDGYREGPSARFRDEPPARPPAGPRSD
FT                   GYREGPSPRFRDDGAPARGRPGPTPPPNARQGGERGDGGRRAPGPGRGPEYGRAGRPDP
FT                   GRGHRGEPPRAGARGAGGPADEMYRSSTDPRQRPPARTDDGLEALEPLDGFDDAETRLP
FT                   SRAANHPGDDRRRRGW"
     MGVLQRFERR LGGLVEGAFA KVFKGGVEPV EIASALARET DDRRASSSNR VLVPNEFAVE        60
     LAGGDFARLA PYTRALCDEL AEMVREHAAE QRYTFVGPVT VRLAEAADLD IGVFRIRSSV       120
     ASADPAVVGG RRPRPRPAAP GTPHLLITTR APGGSGSGER EYPLDAETTV IGRSVECDIR       180
     LNDTGVSRRH GEIRRLPDGQ FLYVDAGSTN GSLVNGRAAT QVKLVNGDRI ELGTAVVEFR       240
     REEARGATGP RGPRTPVPAR SSPPPGRPTP PPADHRTPPP FDPRQPTPST RRGTPSPDDR       300
     YARPEPGVPG GPGGREPGYR DRPGRDPRDG DYREGPSPRF RDDPPGRPAG DHRPDAYREG       360
     PSPRFRDEPG APPDGYREGP SARFRDEPPA RPPAGPRSDG YREGPSPRFR DDGAPARGRP       420
     GPTPPPNARQ GGERGDGGRR APGPGRGPEY GRAGRPDPGR GHRGEPPRAG ARGAGGPADE       480
     MYRSSTDPRQ RPPARTDDGL EALEPLDGFD DAETRLPSRA ANHPGDDRRR RGW              533
//

If you have problems or comments...

PBIL Back to PBIL home page