(data stored in ACNUC7421 zone)

EMBL: CP000820.PE14

CP000820.PE14        Location/Qualifiers
FT   CDS             20169..20873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0014"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL0027
FT                   putative transcriptional regulator (HTH-type)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09483"
FT                   /db_xref="GOA:A8LB29"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB29"
FT                   /protein_id="ABW09483.1"
FT                   /translation="MPPDDPAAECVRPRRGRPRDATIDDRVLRAAVDELAGRGVGGFSV
FT                   NSVAARAGVAKRGIYTRWATRDDLVLAALGTLAAGLVPPRTGSLREDLLRLAPLVDAVF
FT                   TEPRMSILARCLAELPRYPGLYEAFRRESVDRCAAAVQDAFHDARRRGEIRSDLDTDLA
FT                   AAAFLGALLTRQAFGRQAFGRPRAGPGGPGGPGGEPGEPPEPPGAVTAYHRRLVEFSLA
FT                   AARGAGQAFGPA"
     MPPDDPAAEC VRPRRGRPRD ATIDDRVLRA AVDELAGRGV GGFSVNSVAA RAGVAKRGIY        60
     TRWATRDDLV LAALGTLAAG LVPPRTGSLR EDLLRLAPLV DAVFTEPRMS ILARCLAELP       120
     RYPGLYEAFR RESVDRCAAA VQDAFHDARR RGEIRSDLDT DLAAAAFLGA LLTRQAFGRQ       180
     AFGRPRAGPG GPGGPGGEPG EPPEPPGAVT AYHRRLVEFS LAAARGAGQA FGPA             234
//

If you have problems or comments...

PBIL Back to PBIL home page