(data stored in ACNUC7421 zone)

EMBL: CP000820.PE140

CP000820.PE140       Location/Qualifiers
FT   CDS             complement(171414..172289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09609"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH0"
FT                   /protein_id="ABW09609.1"
FT                   /translation="MGESTAGAGPTSATGARRRRGTGRDRAGLGGAGRGAGRGAGRGRL
FT                   VRAAGALCAVAIILLVGGCDEVLDATAGDPTAAPAPAPGGGGVSGAGAPPGAGSALQVL
FT                   GTLPIRAEDNSPPYKRNEFGTAWSDVDHNGCDTRNDILHRDLRSITTRSNDDCIVLTGE
FT                   LRDPYTTRIIRFDRGRNSSAVQIDHVIPLADAWRTGALEWTAKERLGFANDPENLLAVD
FT                   GPTNQQKSDQDASEWLPPSPGIRCAYIARQVGLKARYGLWVEQAEADAMRQVLQSCPQQ
FT                   PPLGMAAASG"
     MGESTAGAGP TSATGARRRR GTGRDRAGLG GAGRGAGRGA GRGRLVRAAG ALCAVAIILL        60
     VGGCDEVLDA TAGDPTAAPA PAPGGGGVSG AGAPPGAGSA LQVLGTLPIR AEDNSPPYKR       120
     NEFGTAWSDV DHNGCDTRND ILHRDLRSIT TRSNDDCIVL TGELRDPYTT RIIRFDRGRN       180
     SSAVQIDHVI PLADAWRTGA LEWTAKERLG FANDPENLLA VDGPTNQQKS DQDASEWLPP       240
     SPGIRCAYIA RQVGLKARYG LWVEQAEADA MRQVLQSCPQ QPPLGMAAAS G                291
//

If you have problems or comments...

PBIL Back to PBIL home page