(data stored in ACNUC7421 zone)

EMBL: CP000820.PE141

CP000820.PE141       Location/Qualifiers
FT   CDS             172402..173202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0143"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL6746
FT                   putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09610"
FT                   /db_xref="GOA:A8LCH1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH1"
FT                   /protein_id="ABW09610.1"
FT                   /translation="MPGPVSWAPGNGRMGRPRAEPVFSRRAGAETAPARHLSSIPVPPG
FT                   PARARPVSRPPGSPRPLRCDAERNRERVLVAARELFVEQGLDVGVDEIVKRAGVGMGTL
FT                   YRRFPNKDALIEAILGTVVDHLRSIAEDVLATEPPTVALRSFFVRSITTEVCQWAFLSS
FT                   RLWRGRTNELLFADVVPLIGEMFTQAQQAGAVRPDVVLSDLIVLVRSMRVVLDLTDGFA
FT                   PEVWRRHLDLLLDGLRPCSGNAVLDVGPMPFDALAISAAARPLV"
     MPGPVSWAPG NGRMGRPRAE PVFSRRAGAE TAPARHLSSI PVPPGPARAR PVSRPPGSPR        60
     PLRCDAERNR ERVLVAAREL FVEQGLDVGV DEIVKRAGVG MGTLYRRFPN KDALIEAILG       120
     TVVDHLRSIA EDVLATEPPT VALRSFFVRS ITTEVCQWAF LSSRLWRGRT NELLFADVVP       180
     LIGEMFTQAQ QAGAVRPDVV LSDLIVLVRS MRVVLDLTDG FAPEVWRRHL DLLLDGLRPC       240
     SGNAVLDVGP MPFDALAISA AARPLV                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page