(data stored in ACNUC7421 zone)

EMBL: CP000820.PE142

CP000820.PE142       Location/Qualifiers
FT   CDS             complement(173237..175087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0144"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   fal:FRAAL6745 putative serine-threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09611"
FT                   /db_xref="GOA:A8LCH2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH2"
FT                   /protein_id="ABW09611.1"
FT                   /translation="MDHNGERVAPAARGQPGGMAPPGEVLHPHEPRAIGPYRLLRRLGA
FT                   GGMGTVYLAESAGRRVAVKVVRPDLAADEEFRRRFRQEVDAARRVAPFCTAEVLDADPD
FT                   AAAPYLVTEFIDGVRLDHAVENGPISGSTLTGLAVGVATALTAIHGSGLVHRDLKPSNV
FT                   LLSMSGPRVIDFGIAQALEGAKAKPTAWGFGSAGWMAPEQVNGQAIGPEADVFTWGILV
FT                   AYAGTGHHPFGTGTDLELSTRIVGSRPALDGLPHDLKALVAAALAKNPDDRPNARDLLL
FT                   SLISLPPTRSGDGRDDGTGRPSASAVGQAEELLNLTRGTTLPGLAPTRVAPGTSGERAP
FT                   ASHGGPPGHGGGAGPSGVAVPAPAGAPAFSGAPGAARGPAPGGGPAGFGPSGFRPAGAG
FT                   AAPHPPTHGPNPPVQGPRPPGQGPYPPVPSGTSQPRSTWHRVLLFGAAALAVVLAAWLI
FT                   SSVAGGSDDPGAVSGAGDRPAASQQPTTPRSGGLNTPVRDDQLEFTASKISCGADHVGD
FT                   GFLARRPSGQFCLVDMKITNVGTAERVLSNSNQYLHTSDGGRHAADFLARYWINDGIWD
FT                   TISPGATVTGTFVFDIPVDAEAEELELHERPESPGVTIQP"
     MDHNGERVAP AARGQPGGMA PPGEVLHPHE PRAIGPYRLL RRLGAGGMGT VYLAESAGRR        60
     VAVKVVRPDL AADEEFRRRF RQEVDAARRV APFCTAEVLD ADPDAAAPYL VTEFIDGVRL       120
     DHAVENGPIS GSTLTGLAVG VATALTAIHG SGLVHRDLKP SNVLLSMSGP RVIDFGIAQA       180
     LEGAKAKPTA WGFGSAGWMA PEQVNGQAIG PEADVFTWGI LVAYAGTGHH PFGTGTDLEL       240
     STRIVGSRPA LDGLPHDLKA LVAAALAKNP DDRPNARDLL LSLISLPPTR SGDGRDDGTG       300
     RPSASAVGQA EELLNLTRGT TLPGLAPTRV APGTSGERAP ASHGGPPGHG GGAGPSGVAV       360
     PAPAGAPAFS GAPGAARGPA PGGGPAGFGP SGFRPAGAGA APHPPTHGPN PPVQGPRPPG       420
     QGPYPPVPSG TSQPRSTWHR VLLFGAAALA VVLAAWLISS VAGGSDDPGA VSGAGDRPAA       480
     SQQPTTPRSG GLNTPVRDDQ LEFTASKISC GADHVGDGFL ARRPSGQFCL VDMKITNVGT       540
     AERVLSNSNQ YLHTSDGGRH AADFLARYWI NDGIWDTISP GATVTGTFVF DIPVDAEAEE       600
     LELHERPESP GVTIQP                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page