(data stored in ACNUC7421 zone)

EMBL: CP000820.PE146

CP000820.PE146       Location/Qualifiers
FT   CDS             178026..178289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0148"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: fal:FRAAL6738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09615"
FT                   /db_xref="GOA:A8LCH6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH6"
FT                   /protein_id="ABW09615.1"
FT                   /translation="MTRVVVDVMLKPEILDPQGQAVLTALPRLGVAGISGVRQGKRFEL
FT                   DLDGEADAEALARIEHLASTLLANPVIEDYVVRVEPARVEAD"
     MTRVVVDVML KPEILDPQGQ AVLTALPRLG VAGISGVRQG KRFELDLDGE ADAEALARIE        60
     HLASTLLANP VIEDYVVRVE PARVEAD                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page